AV45602

Anti-ESRRG antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DKFZp781L1617, Anti-ERR3, Anti-Estrogen-related receptor γ, Anti-FLJ16023, Anti-KIAA0832, Anti-NR3B3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 51 kDa
• Speziesreaktivität: guinea pig, horse, rat, human, bovine, dog, rabbit, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001127757
• UniProt-Hinterlegungsnummer: P62508
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ESRRG(2104)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human ESRRG

Anwendung

Anti-ESRRG antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem./physiol. Wirkung

Estrogen-related receptor gamma (ESRRG) is an orphan nuclear receptor that belongs to the estrogen receptor-related receptor family. ESRR family members have the same set of target genes and regulators as the estrogen receptors. ESRRG acts as a transcriptional activator of DNA cytosine-5-methyltransferases 1 and modulates cell proliferation, osteoblast differentiation and bone formation and energy metabolism in human trophoblasts. Studies indicate that this receptor mediates antidiabetic effect as it inhibits hepatic gluconeogenesis.

Sequenz

Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable