Direkt zum Inhalt
Merck

AV39473

Sigma-Aldrich

Anti-LZTS1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(e):

Anti-Leucine zipper, putative tumor suppressor 1

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

IgG fraction of antiserum

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

67 kDa

Speziesreaktivität

horse, rat, guinea pig, mouse, bovine, human

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Angaben zum Gen

human ... LZTS1(11178)

Allgemeine Beschreibung

Leucine zipper, putative tumor suppressor 1 (LZTS1) is a protein that regulates the molecular events involved in progression of cells through the M phase of mitosis. It functions as a tumor suppressor for a range of major cancer histotypes, such as bladder cancer and urothelial carcinomas. LZTS1 is transiently expressed at the border of the ventricular and mantle zones in subsets of sensory and motor spinal neurons.

Spezifität

Anti-LZTS1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine leucine zipper, putative tumor suppressor 1 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human LZTS1

Anwendung

Anti-LZTS1 polyclonal antibody is used to tag leucine zipper, putative tumor suppressor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine zipper, putative tumor suppressor 1 as a tumor suppressor gene and mediator of M-phase cell cycle progression.

Biochem./physiol. Wirkung

Leucine zipper putative tumor suppressor 1 (LZTS1) is a tumor suppressor gene involved in the cell growth activity. It is down-regulated in several human malignancies. It retards the growth in cancer cells by regulating the mitotic process. It restricts Cdk1 (Cyclin-Dependent Kinase 1) activity by steadying the Cdc25C (cell division cycle 25C) phosphatase, a mitotic activator of Cdk1. Deregulation of this gene is associated with breast cancer and may serve as a prognostic factor for breast cancer therapy. It is found to be down-regulated by promoter methylation. This gene is found to be involved in ovarian carcinogenesis.

Sequenz

Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Francesca Lovat et al.
Oncotarget, 5(4), 970-977 (2014-01-23)
The Leucine Zipper Tumor Suppressor 1 (LZTS1) is a tumor suppressor gene, located at chromosome 8p22, which is frequently altered in human cancer. In normal tissue, its ubiquitous expression regulates cell mitosis by the stabilization of microtubule networks. LZTS1-deficient mouse
H Ishii et al.
Proceedings of the National Academy of Sciences of the United States of America, 96(7), 3928-3933 (1999-03-31)
Alterations of human chromosome 8p occur frequently in many tumors. We identified a 1.5-Mb common region of allelic loss on 8p22 by allelotype analysis. cDNA selection allowed isolation of several genes, including FEZ1. The predicted Fez1 protein contained a leucine-zipper
Xin-Xin Wang et al.
Human pathology, 42(10), 1410-1419 (2011-03-23)
Leucine zipper putative tumor suppressor 1 is down-regulated by promoter methylation, but not frequently, in human malignancies, including breast cancer. Recent studies suggest that leucine zipper putative tumor suppressor 1 is a candidate for the metastasis modifier locus on human
Andrea Vecchione et al.
Cancer cell, 11(3), 275-289 (2007-03-14)
The FEZ1/LZTS1 (LZTS1) protein is frequently downregulated in human cancers of different histotypes. LZTS1 is expressed in normal tissues, and its introduction in cancer cells inhibits cell growth and suppresses tumorigenicity, owing to an accumulation of cells in G2/M. Here
Daniela Califano et al.
Journal of cellular physiology, 222(2), 382-386 (2009-11-04)
The FEZ1/LZTS1 (FEZ1) gene maps to chromosome 8p22 and is frequently altered in human cancer. FEZ1 has been proposed as a candidate tumour suppressor gene and its loss may contribute to tumour progression. We have analysed the expression of FEZ1

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.