AV39110

Anti-CXXC1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-2410002I16Rik, Anti-5830420C16Rik, Anti-CGBP, Anti-CXXC finger 1 (PHD domain), Anti-HsT2645, Anti-PCCX1, Anti-PHF18, Anti-hCGBP
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 76 kDa
• Speziesreaktivität: guinea pig, dog, horse, rabbit, mouse, rat, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_055408
• UniProt-Hinterlegungsnummer: Q9P0U4
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CXXC1(30827)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human CXXC1

Biochem./physiol. Wirkung

CXXC1 (CXXC finger protein 1) is a component of euchromatic Setd1A histone H3K4 methyltransferase complex. It regulates histone and cytosine methylation which in turn mediates cellular differentiation and development in vertebrates.

Sequenz

Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable