AV36331

Anti-AKAP7 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-A kinase (PRKA) anchor protein 7
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 36 kDa
• Speziesreaktivität: guinea pig, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_057461
• UniProt-Hinterlegungsnummer: Q9P0M2
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... AKAP7(9465)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human AKAP7

Biochem./physiol. Wirkung

A kinase (PRKA) anchor protein 7 (AKAP7) is a scaffolding protein that directs enzyme activity of protein kinases towards specific substrates. It also retains PKA and PKC in distinct subcellular compartments thus restricts the mobility of these ubiquitous enzymes with the cells.

Sequenz

Synthetic peptide located within the following region: LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable