AV100841

Anti-IRF8 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Interferon regulatory factor 8
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 48 kDa
• Speziesreaktivität: human, dog, rat, horse, rabbit, guinea pig, mouse, bovine
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_002154
• UniProt-Hinterlegungsnummer: Q02556
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... IRF8(3394)

Beschreibung

Allgemeine Beschreibung

Interferon regulatory factors are transcription factors that regulate the expression of interferon system. The activity of IRF-8 has been implicated in vascular diseases.

Immunogen

Synthetic peptide directed towards the N terminal region of human IRF8

Anwendung

Anti-IRF8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Biochem./physiol. Wirkung

IRF-8 regulates the activity of myocardin and modulates the phenotype of smooth muscle cells. It regulates the development and function of T cells, B cells and macrophages. IRF-8 induces the production of type 1 interferons in dendritic cells.

Sequenz

Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable