AMAB91821

Anti-WFDC2 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12917, purified by using Protein A, buffered aqueous glycerol solution

• Synonym(e): dJ461P17.6,EDDM4,HE4,WAP5
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörper-Produkttyp: primary antibodies
• Klon: CL12917, monoclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Aufgereinigt durch: using Protein A
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:20-1:50
• Isotyp: IgG1
• Ensembl | Human Hinterlegungsnummer: ENSG00000101443
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... WFDC2(10406)

Beschreibung

Immunogen

Wap four-disulfide core domain 2

Anwendung

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Leistungsmerkmale und Vorteile

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Sequenz

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Verlinkung

Corresponding Antigen APREST84772

Physikalische Form

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Lagerung und Haltbarkeit

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1