Direkt zum Inhalt
Merck

AMAB91116

Sigma-Aldrich

Monoclonal Anti-SLC6A2 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL3063, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(e):

NAT1, NET1, SLC6A2, SLC6A5

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

CL3063, monoclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human, rat, mouse

Methode(n)

immunohistochemistry: 1:200-1:500

Isotyp

IgG1

Immunogene Sequenz

SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... NET(6530)

Allgemeine Beschreibung

Sodium-dependent noradrenaline transporter (NET) is also called solute carrier family 6 member 2 (SLC6A2). The SLC6A2 gene is mapped to locus 16q12.2 in the human chromosome. The sodium-dependent noradrenaline transporter (NET) belongs to sodium and chloride-dependent neurotransmitter transporter family and is a glycosylated protein.

Immunogen

Solute carrier family 6 member 2

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Regulation of noradrenalin transport is the primary function of the norepinephrine transporter (NET).It is crucial for neuronal function and regulates neurotransmitter uptake in the central nervous system. Polymorphisms in NET gene is implicated in attention-deficit/hyperactivity disorder (ADHD). Mutations in NET impacts the transport functionality resulting in orthostatic intolerance disorder. Polymorphisms of SLC6A2 impacts neurotransmission in patients with major depressive disorder.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86859

Physikalische Form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Alleviating transcriptional inhibition of the norepinephrine slc6a2 transporter gene in depolarized neurons
Harikrishnan KN, et al.
The Journal of Neuroscience, 30(4), 1494-1501 (2010)
Monoamine transporter gene polymorphisms affect susceptibility to depression and predict antidepressant response
Min W, et al.
Psychopharmacology, 205(3), 409-417 (2009)
A mutation in the human norepinephrine transporter gene (SLC6A2) associated with orthostatic intolerance disrupts surface expression of mutant and wild-type transporters
Hahn MK, et al.
The Journal of Neuroscience, 23(11), 4470-4478 (2003)
Differential association between the norepinephrine transporter gene and ADHD: role of sex and subtype
Sengupta SN, et al.
Journal of Psychiatry & Neuroscience, 37(2), 129-129 (2012)
Association between norepinephrine transporter gene (SLC6A2) polymorphisms and suicide in patients with major depressive disorder
Kim YK, et al.
Journal of Affective Disorders, 158, 127-132 (2014)

Global Trade Item Number

SKUGTIN
AMAB91116-100UL4061837049316
AMAB91116-25UL4061841323020

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.