Skip to Content
Merck
All Photos(9)

Key Documents

HPA001636

Sigma-Aldrich

Anti-TJP1 antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Tight junction protein 1 antibody produced in rabbit, Anti-Tight junction protein ZO-1 antibody produced in rabbit, Anti-Zona occludens 1 protein antibody produced in rabbit, Anti-Zonula occludens 1 protein antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL

immunogen sequence

RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TJP1(7082)

Looking for similar products? Visit Product Comparison Guide

General description

Tight junction protein 1/Zona occludens 1 protein (TJP1, ZO-1) is a membrane-associated guanylate kinase, associated with cytoplasmic membrane surface of intercellular tight junctions. ZO-1 gene is mapped to human chromosome 15q13.1. It comprises a guanylate kinase (GUK) domain, three postsynaptic density 95/disc-large/ZO-1 (PDZ) domains, a Src homology 3 domain, actin-binding region and an acidic domain. ZO-1 is observed in the tight junctions associated with epithelia and endothelia.

Specificity

Rabbit polyclonal anti-TJP1 antibody reacts with human tight junction protein 1/zona occludens 1 protein.

Immunogen

Tight junction protein ZO-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Rabbit polyclonal anti-TJP1 antibody is used to tag tight junction protein 1/zona occludens 1 protein for detection and as a probe to determine the presence and roles of tight junction protein 1/zona occludens 1 protein in cell remodeling and tissue organization. It has been used in:
  • immunofluorescent staining
  • immunohistochemistry
  • confocal microscopy
  • immunofluorescence
  • western blotting
  • immunocytochemistry
  • immunoprecipitation

Biochem/physiol Actions

Tight junction protein 1/Zona occludens 1 protein (TJP1/ZO-1) mediates the regulation of cell remodeling and tissue organization in both the embryonic and extraembryonic regions. It binds with other proteins including junctional adhesion molecule (JAM), claudins and occludin. ZO-1 deficiency also favors apoptosis in the embryonic cells. Silencing of the ZO-1 by the microRNA (miR-103) increases endometrial carcinogenesis and could be a potential therapeutic target. The levels of ZO-1 are elevated in hepatocellular carcinoma.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST83050

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Huanhuan Joyce Chen et al.
Lab on a chip, 18(14), 2036-2046 (2018-06-09)
We describe an expanded modular gastrointestinal (GI) tract-liver system by co-culture of primary human intestinal epithelial cells (hIECs) and 3D liver mimic. The two organ body-on-chip design consisted of GI and liver tissue compartments that were connected by fluidic medium
MicroRNA-103 regulates the progression in endometrial carcinoma through ZO-1
Du J, et al.
International Journal of Immunopathology and Pharmacology, 33, 2058738419872621-2058738419872621 (2019)
Innate immune response of human pluripotent stem cell-derived airway epithelium
McIntyre BAS, et al.
Innate Immunity, 21(5), 504-511 (2015)
Increased systemic zonula occludens 1 associated with inflammation and independent biomarker in patients with hepatocellular carcinoma
Ram AK, et al.
BMC Cancer, 18(1), 1-10 (2018)
Melanie A Ruffner et al.
Allergy, 74(12), 2449-2460 (2019-07-04)
Germline-encoded innate immune pattern recognition receptors (PRR) are expressed at epithelial surfaces and modulate epithelial defenses. Evidence suggests that stimulation of the Toll-like receptor (TLR) family of PRR may regulate epithelial barrier integrity by upregulating tight junction (TJ) complex protein

Global Trade Item Number

SKUGTIN
HPA001636-100UL4061837133015
HPA001636-25UL4061842773626

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service