Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

WH0009842M1

Sigma-Aldrich

Monoclonal Anti-PLEKHM1 antibody produced in mouse

clone 1C9, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-AP162, Anti-B2, Anti-KIAA0356, Anti-pleckstrin homology domain containing, family M (with RUN domain) member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1C9, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable

Isotype

IgG2bκ

Numéro d'accès GenBank

BC064361

Numéro d'accès UniProt

Q9Y4G2

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PLEKHM1(9842)

Description générale

The protein encoded by this gene is essential for bone resorption, and may play a critical role in vesicular transport in the osteoclast. Mutations in this gene are associated with autosomal recessive osteopetrosis type 6 (OPTB6). Alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)

Immunogène

PLEKHM1 (AAH64361, 957 a.a. ~ 1056 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA

Actions biochimiques/physiologiques

PLEKHM1 (pleckstrin homology and RUN domain containing M1) is involved in the end stages of endocytic and autophagy pathways. Here, it interacts with RAB7 (member of RAS oncogene family), the HOPS (homotypic fusion and vacuole protein sorting) complex and ATG8 (autophagy-related protein 8) proteins. It plays an important role in autophagosome-lysosome fusion and endosome and autophagosome maturation. PLEKHM1 also participates in osteoclast function and bone resorption. In presence of Salmonella enterica Typhimurium, the PLEKHM1-RAB7-HOPS complex targets the Salmonella effector protein SifA (Salmonella-induced filament protein A) and controls vacuoles consisting of Salmonella.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Simone de Jong et al.
BMC genomics, 13, 458-458 (2012-09-07)
Chromosome 17q21.31 contains a common inversion polymorphism of approximately 900 kb in populations with European ancestry. Two divergent MAPT haplotypes, H1 and H2 are described with distinct linkage disequilibrium patterns across the region reflecting the inversion status at this locus. The
David G McEwan et al.
Molecular cell, 57(1), 39-54 (2014-12-17)
The lysosome is the final destination for degradation of endocytic cargo, plasma membrane constituents, and intracellular components sequestered by macroautophagy. Fusion of endosomes and autophagosomes with the lysosome depends on the GTPase Rab7 and the homotypic fusion and protein sorting
Liesbeth Van Wesenbeeck et al.
The Journal of clinical investigation, 117(4), 919-930 (2007-04-04)
This study illustrates that Plekhm1 is an essential protein for bone resorption, as loss-of-function mutations were found to underlie the osteopetrotic phenotype of the incisors absent rat as well as an intermediate type of human osteopetrosis. Electron and confocal microscopic
David G McEwan et al.
Autophagy, 11(4), 720-722 (2015-04-24)
The endosomal system and autophagy are 2 intertwined pathways that share a number of common protein factors as well as a final destination, the lysosome. Identification of adaptor platforms that can link both pathways are of particular importance, as they
Kazuharu Ienaga et al.
Journal of receptor and signal transduction research, 34(3), 195-200 (2014-03-20)
A creatinine metabolite, 5-hydroxy-1-methylhydantoin (HMH: NZ-419), a hydroxyl radical scavenger, has previously been shown to confer renoprotection by inhibiting the progression of chronic kidney disease in rats. In the current study, we demonstrate that HMH modulates the effects of glucose
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique