WH0009833M1

Monoclonal Anti-MELK antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-HPK38, Anti-KIAA0175, Anti-maternal embryonic leucine zipper kinase
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4D8, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC014039
• Numéro d'accès UniProt: Q14680
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MELK(9833)

Description

Description générale

The maternal embryonic leucine zipper kinase (MELK) is a member of the CAMK serine/threonine protein kinase superfamily. It is expressed at high level in oocytes, spermatogonia and embryos. This gene is mapped to human chromosome 9p13.

Immunogène

MELK (AAH14039, 550 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK

Actions biochimiques/physiologiques

The maternal embryonic leucine zipper kinase (MELK) prevents HIV-1 (human immunodeficiency virus) replication. It participates in cell cycle, cytokinesis, mRNA splicing and apoptosis. MELK also plays an important role in the development of germ cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)