WH0008805M1

Monoclonal Anti-TRIM24 antibody produced in mouse

clone 2F2, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-PTC6, Anti-RNF82, Anti-TF1A, Anti-TIF1, Anti-TIF1A, Anti-TIF1ALPHA, Anti-hTIF1, Anti-tripartite motif-containing 24
• Code UNSPSC : 12352203

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2F2, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG3κ
• Numéro d'accès GenBank: BC028689
• Numéro d'accès UniProt: O15164
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TRIM24(8805)

Description

Description générale

Tripartite motif-containing 24 (TRIM24) is a co-regulator that belongs to the transcription intermediary factor 1 family. It is also known as transcription intermediary factor 1α (TIF1α). TRIM24 has an amino-terminal RING-B boxes-coiled coil (RBCC/TRIM) motif, a carboxy-terminal plant homeodomain (PHD) finger-bromodomain unit and a nuclear receptor interaction box (NR box or LXXLL motif). This gene is located on human chromosome 7q33-q34.

Immunogène

TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW

Actions biochimiques/physiologiques

Tripartite motif-containing 24 (TRIM24) acts as a potential prognostic biomarker for ESCC (esophageal squamous cell cancer). This protein induces the development of tumor and generates chemotherapy resistance through the phosphatidylinositide 3-kinase (PI3K)/Akt pathway. TRIM24 modulates p53 protein levels by changing the stability of p53.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)