Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0005223M1

Sigma-Aldrich

Monoclonal Anti-PGAM1 antibody produced in mouse

clone 2G1-A6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-PGAMA, Anti-phosphoglycerate mutase 1 (brain)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Clone:
2G1-A6, monoclonal
application:
ELISA (i)
WB
Espèces réactives:
human
Technique(s):
indirect ELISA: suitable
western blot: 1-5 μg/mL
citations:
5

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2G1-A6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PGAM1(5223)

Description générale

Phosphoglycerate mutase 1 (PGAM1) is an important glycolytic enzyme. This gene is located on human chromosome 10q24.

Immunogène

PGAM1 (AAH11678.1, 1 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Application

Monoclonal Anti-PGAM1 antibody has been used in western blotting.

Actions biochimiques/physiologiques

Phosphoglycerate mutase 1 (PGAM1) participates in glycolysis, pentose phosphate pathway and serine biosynthesis in cancer cells. It helps to convert 3-phosphoglycerate (3-PG) into 2-PG in glycolysis. PGAM1 is essential to support glycolysis for normal cell activities.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Identification of proteins with different abundance associated with cell migration and proliferation in leiomyoma interstitial fluid by proteomics
Ura B, et al.
Oncology Letters, 13(5), 3912-3920 (2017)
Bisphosphoglycerate mutase controls serine pathway flux via 3-phosphoglycerate
Oslund RC, et al.
Nature Chemical Biology, 13(10), 1081-1087 (2017)
CHUK, a conserved helix-loop-helix ubiquitous kinase, maps to human chromosome 10 and mouse chromosome 19
Mock BA, et al.
Genomics, 27(2), 348-351 (1995)
Phosphoglycerate mutase 1 regulates dNTP pool and promotes homologous recombination repair in cancer cells
Qu J, et al.
The Journal of Cell Biology, 216(2), 409-424 (2017)
Blendi Ura et al.
Oncology letters, 13(5), 3912-3920 (2017-05-20)
Uterine leiomyoma is the most common female reproductive tract benign tumor. Little is known about protein composition and changes in the leiomyoma interstitial fluid (IF). The present study focused on changes in protein abundance in the IF of leiomyoma. Leiomyoma

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique