Accéder au contenu
Merck
Toutes les photos(6)

Principaux documents

WH0004435M1

Sigma-Aldrich

Monoclonal Anti-CITED1 antibody produced in mouse

clone 6G8, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1, Anti-MSG1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Conjugué:
unconjugated
application:
ELISA (i)
WB
Clone:
6G8, monoclonal
Espèces réactives:
human, rat, mouse
citations:
4
Technique(s):
indirect ELISA: suitable
western blot: 1-5 μg/mL

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6G8, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human, rat, mouse

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CITED1(4435)

Description générale

CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) is a non-DNA binding transcriptional co-activator. It has a smad-4 interacting domain (SID) and a conserved region 2 (CR2) domain. This gene codes for a 27 kDa protein that belongs to the CITED (CBP/p300-interacting transactivators with glutamic acid [E] and aspartic acid [D]-rich C-terminal domain) family of nuclear proteins. CITED1 is located on human chromosome Xq13.
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. (provided by RefSeq)

Immunogène

CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Actions biochimiques/physiologiques

CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) controls cellular activities of the metanephric mesenchyme. This gene is linked to papillary thyroid carcinoma. MSG1 is involved in pigmentation. It also participates in malignant transformation of pigment cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Galectin-3, fibronectin-1, CITED-1, HBME1 and cytokeratin-19 immunohistochemistry is useful for the differential diagnosis of thyroid tumors
Prasad ML, et al.
Modern Pathology, 18(1), 48-57 (2005)
Aberrant expression of MSG1 transcriptional activator in human malignant melanoma in vivo
Ahmed NU, et al.
Pigment Cell Research / Sponsored by the European Society for Pigment Cell Research and the International Pigment Cell Society, 14(2), 140-143 (2001)
Wilms' tumorigenesis is altered by misexpression of the transcriptional co-activator, CITED1
Lovvorn HN 3rd, et al.
Journal of Pediatric Surgery, 42(3), 474-481 (2007)
Establishment and genetic characterization of a novel mixed-phenotype acute leukemia cell line with EP300-ZNF384 fusion
Ping N, et al.
Journal of Hematology & Oncology (2015)
Establishment and genetic characterization of a novel mixed-phenotype acute leukemia cell line with EP300-ZNF384 fusion
Ping N, et al.
Journal of Hematology & Oncology, 8(1), 100-100 (2015)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique