WH0004082M6

Monoclonal Anti-MARCKS antibody produced in mouse

clone 2C2, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-80KL, Anti-FLJ14368, Anti-MACS, Anti-MRACKS, Anti-PKCSL, Anti-PRKCSL, Anti-myristoylated alanine-rich protein kinase C substrate
• Numéro MDL: MFCD01633619
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2C2, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: mouse
• Technique(s): immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: NM_002356
• Numéro d'accès UniProt: P26645
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MARCKS(4082)

Description

Description générale

Myristoylated alanine-rich C-kinase substrate (MARCKS) contains an N-terminal domain (ND), effector domain (ED), and myristoylated MH2 domain. The MARCKS gene is mapped to human chromosome 6q21.

Immunogène

MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP

Application

Monoclonal Anti-MARCKS antibody produced in mouse has been used in immunohistochemistry (1:400).

Actions biochimiques/physiologiques

Myristoylated alanine-rich C-kinase substrate (MARCKS) is involved in mediating brain plasticity, inflammatory response, embryonic development, and regeneration processes. It also plays a key role in cell cycle regulation and transmembrane transport. Various studies have implicated the association of MARCKS with the pathophysiology of glioblastoma, cholangiocarcinoma, melanoma, and many more tumor types.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)