WH0003170M1
Monoclonal Anti-FOXA2 antibody produced in mouse
clone 7E6, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
Anti-HNF3B, Anti-MGC19807, Anti-TCF3B, Anti-forkhead box A2
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
7E6, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
Isotype
IgG2aκ
Numéro d'accès GenBank
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... FOXA2(3170)
Description générale
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)
Immunogène
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Actions biochimiques/physiologiques
Forkhead box A2 (FOXA2) expressed in the liver, pancreas, intestine, and lungs, is associated with embryonic formation of the primitive streak and endoderm. It also plays an important role in airway epithelial differentiation and is extensively expressed in type II pneumocytes. Decreased expression of Foxa2 is observed in lung cancer and non-small-cell lung cancer (NSCLC). FOXA2 plays a vital role in normal pancreatic β-cell function, therefore, aberration in the expression of the gene leads to hyperinsulinemic hypoglycemia. FOXA2 also has an essential role in pancreatic α-cell differentiation. FOXA2 expressed along with FOXA1 in the foregut endoderm plays a vital role in liver, hepatic and neuronal development, these factors also have an overlapping role in lung morphogenesis. FOXA2 acts a regulator of the network of gene associated with the intestinal epithelial cell function. Increased expression of FOXA2 in MKN-45 cells (human gastric cancer cell line) elevates E-cadherin expression and inhibits gastric cancer cell migration and invasion and therefore, FOXA2 is expressed at low levels in gastric adenocarcinoma tissues.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Informations légales
GenBank is a registered trademark of United States Department of Health and Human Services
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Zhengliang Zhang et al.
Xi bao yu fen zi mian yi xue za zhi = Chinese journal of cellular and molecular immunology, 31(5), 672-676 (2015-05-06)
To investigate the expression of FOXA2 in human gastric adenocarcinoma and its correlation with cell migration and invasion. Fifty-six pairs of gastric adenocarcinoma and matched tumor-adjacent tissues were freshly collected. The expressions of FOXA2 and epithelial cadherin (E-cadherin) in the
Daniela S Basseres et al.
Lung cancer (Amsterdam, Netherlands), 77(1), 31-37 (2012-02-22)
We sought to determine the mechanisms of downregulation of the airway transcription factor Foxa2 in lung cancer and the expression status of Foxa2 in non-small-cell lung cancer (NSCLC). A series of 25 lung cancer cell lines were evaluated for Foxa2
Catherine S Lee et al.
Developmental biology, 278(2), 484-495 (2005-02-01)
The differentiation of insulin-producing beta-cells has been investigated in great detail; however, little is known about the factors that delineate the second-most abundant endocrine lineage, the glucagon-producing alpha-cell. Here we utilize a novel YAC-based Foxa3Cre transgene to delete the winged
Nehal Gosalia et al.
Physiological genomics, 47(7), 290-297 (2015-04-30)
The forkhead box A (FOXA) family of pioneer transcription factors is critical for the development of many endoderm-derived tissues. Their importance in regulating biological processes in the lung and liver is extensively characterized, though much less is known about their
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique