Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0002246M1

Sigma-Aldrich

Monoclonal Anti-FGF1 antibody produced in mouse

clone 3F5, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-AFGF, Anti-ECGF, Anti-ECGFA, Anti-ECGFB, Anti-ECGFbeta, Anti-FGFA, Anti-FGFalpha, Anti-GLIO703, Anti-HBGF1, Anti-fibroblast growth factor 1 (acidic)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3F5, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FGF1(2246)

Description générale

FGF1 (fibroblast growth factor 1) gene encodes a member of the fibroblast growth factor (FGF) family. It encodes a pro-angiogenic protein that is ubiquitously expressed. In humans, FGF1 is alternatively spliced into four forms: FGF1A (in kidney), FGF1B (in brain), FGF1-C and -D (in vascular smooth muscle cells and fibroblasts). This gene is located on human chromosome 5q31.
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. (provided by RefSeq)

Immunogène

FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Actions biochimiques/physiologiques

FGF1 (fibroblast growth factor 1) is mainly involved in cell growth, proliferation and neurogenesis. This gene also participates in wound healing, post-ischemic heart repair and making of collaterals after hindlimb ischemia. The protein functions as an angiogenic factor that participates in tissue repair, carcinogenesis, and maintenance of vasculature stability.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Transgenic expression of nonclassically secreted FGF suppresses kidney repair
Kirov A, et al.
PLoS ONE (2012)
Upregulation of fibroblast growth factor 1 in the synovial membranes of patients with late stage osteoarthritis
Li R, et al.
Genetics and molecular research : GMR (2015)
Regulation of FGF1 gene promoter through transcription factor RFX1
Hsu YC, et al.
The Journal of Biological Chemistry, 285(18), 13885-13895 (2010)
Fibroblast growth factors
Ornitz DM and Itoh N
Genome Biology (2001)
Folding of Fibroblast Growth Factor 1 Is Critical for Its Nonclassical Release
Prudovsky I, et al.
Biochemistry, 55(7), 1159-1167 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique