WH0000130M1

Monoclonal Anti-ADH6 antibody produced in mouse

clone 4G4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-ADH5, Anti-alcohol dehydrogenase 6 (class V)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4G4, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_000672
• Numéro d'accès UniProt: P28332
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ADH6(130)

Description

Description générale

This gene encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This gene is expressed in the stomach as well as in the liver, and it contains a glucocorticoid response element upstream of its 5′ UTR, which is a steroid hormone receptor binding site. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogène

ADH6 (NP_000663, 55 a.a. ~ 144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)