SAB5702942

Anti-Neurogenin 2 Antibody, clone 8F2Q8, Rabbit Monoclonal

• Synonyme(s) : Atoh4, Math4A, NGN2, bHLHa8, ngn-2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 8F2Q8, monoclonal
• Forme: liquid
• Poids mol.: 29 kDa
• Espèces réactives: human, rat, rat
• Concentration: 2.00 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: GARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK
• Numéro d'accès UniProt: Q9H2A3
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NEUROG2(63973)

Description

Description générale

This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The protein product of this gene also plays a role in the differentiation and survival of midbrain dopaminergic neurons. [provided by RefSeq, Apr 2012]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Neurogenin 2 (Q9H2A3).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1