SAB5702178

Anti-Thyroid Peroxidase Antibody, clone 3C4A4, Rabbit Monoclonal

• Synonyme(s) : MSA, TDH2A, TPX
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 3C4A4, monoclonal
• Forme: liquid
• Espèces réactives: rat, human, rat
• Concentration: 1.09 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQA
• Numéro d'accès UniProt: P07202
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TPO(7173)

Description

Description générale

This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, May 2011]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thyroid Peroxidase (P07202).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1