SAB5702111

Anti-TSC2 Antibody, clone 7X2C6, Rabbit Monoclonal

• Synonyme(s) : LAM,PPP1R160,TSC4,TSC2,Tuberin,tuberin
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7X2C6, monoclonal
• Forme: liquid
• Poids mol.: 200 kDa
• Espèces réactives: human
• Concentration: 0.52 mg/mL
• Technique(s): immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: AKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
• Numéro d'accès UniProt: P49815
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TSC2(7249)

Description

Description générale

Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1700-1807 of human Tuberin (P49815).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB,IP

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1