SAB5701988

Anti-SSCA1/SerpinB3 Antibody, clone 6J3U6, Rabbit Monoclonal

• Synonyme(s) : SERPINB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 6J3U6, monoclonal
• Forme: liquid
• Espèces réactives: rat, human, rat
• Concentration: 2 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
• Numéro d'accès UniProt: P29508
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SerpinB3(6317)

Description

Description générale

Serpin B3, also known as squamous cell carcinoma antigen-1 (SCCA-1), is a member of the serpin superfamily of serine protease inhibitors. Serpin B3 belongs to the subgroup ovalbumin-related serpins which are involved in the regulation of apoptosis, inflammation, angiogenesis and embryogenesis. It may act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. It also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).

Immunogène

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 301-390 of human SSCA1/SerpinB3 (P29508).

Application

IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1