Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

SAB2108757

Sigma-Aldrich

Anti-SLC10A1

affinity isolated antibody

Synonyme(s) :

Anti- NTCP1, Anti-NTCP

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

38 kDa

Espèces réactives

mouse, human, guinea pig, dog, rat

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable

Numéro d'accès

NM_003049

Numéro d'accès UniProt

Q14973

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC10A1(6554)

Description générale

The gene SLC10A1 (solute carrier family 10 member 1) is mapped to human chromosome 14q24.2. It is mainly expressed in the liver cells.

Immunogène

Synthetic peptide directed towards the middle region of human SLC10A1

Actions biochimiques/physiologiques

SLC10A1 (solute carrier family 10 member 1) is a bile acid transporter. It plays an important role in the circulation of bile acids. Mutation in this gene is associated with hypercholanemia. SLC10A1 also plays an important role in the entry of HBV (Hepatitis B virus) and silencing of this gene inhibits HBV infection. It works as a receptor for preS1 domain in HBV.

Séquence

Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Clinical and molecular study of a pediatric patient with sodium taurocholate cotransporting polypeptide deficiency.
Deng M, et al.
Experimental and Therapeutic Medicine, 12, 3294-3300 (2016)
Hepatitis B virus efficiently infects non-adherent hepatoma cells via human sodium taurocholate cotransporting polypeptide.
Okuyama-Dobashi K, et al.
Scientific Reports, 5, 17047-17047 (2015)
A genetic variant of the NTCP gene is associated with HBV infection status in a Chinese population.
Yang J, et al.
BMC Cancer, 16, 211-211 (2016)
The nuclear receptor FXR, but not LXR, up-regulates bile acid transporter expression in non-alcoholic fatty liver disease.
Aguilar-Olivos NE, et al.
Annals of Hepatology, 14, 487-493 (2015)
Fatemeh Alaei Faradonbeh et al.
Frontiers in physiology, 13, 859294-859294 (2022-04-08)
Multidrug resistance-associated protein 2 (Mrp2) mediates biliary secretion of anionic endobiotics and xenobiotics. Genetic alteration of Mrp2 leads to conjugated hyperbilirubinemia and predisposes to the development of intrahepatic cholestasis of pregnancy (ICP), characterized by increased plasma bile acids (BAs) due
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique