Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB2108487

Sigma-Aldrich

Anti-BTG2

affinity isolated antibody

Synonyme(s) :

Anti- MGC126064, Anti- PC3, Anti- TIS21, Anti-MGC126063

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

17 kDa

Espèces réactives

rat, human

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable

Numéro d'accès

NM_006763

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... BTG2(7832)

Description générale

B-cell translocation gene 2 (BTG2) belongs to the BTG/TOB gene family. It is also called as nerve growth factor (NGF)-inducible anti-proliferative protein PC3 and NGF-inducible protein TIS21. BTG2 encodes a 158 amino acid protein. This gene is located on the long arm of human chromosome 1.

Immunogène

Synthetic peptide directed towards the middle region of human BTG2

Actions biochimiques/physiologiques

B-cell translocation gene 2 (BTG2) is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
It participates in the modulation of cell cycle transition. It has the ability to repress the migration and invasion of osteosarcoma cells.

Séquence

Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

BTG2 inhibits the proliferation and metastasis of osteosarcoma cells by suppressing the PI3K/AKT pathway
Li Yi-Jin, et al.
International Journal of Clinical and Experimental Pathology, 8(10), 12410-12410 (2015)
BTG2: a rising star of tumor suppressors
Mao B, et al.
International journal of oncology, 46(2), 459-464 (2015)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique