Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2102520

Sigma-Aldrich

Anti-TPH2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ37295, Anti-MGC138871, Anti-MGC138872, Anti-NTPH, Anti-Tryptophan hydroxylase 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Conjugué:
unconjugated
application:
WB
Clone:
polyclonal
Espèces réactives:
mouse, rat, human, guinea pig, bovine, dog, rabbit
citations:
2
Technique(s):
western blot: suitable

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

56 kDa

Espèces réactives

mouse, rat, human, guinea pig, bovine, dog, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TPH2(121278)

Immunogène

Synthetic peptide directed towards the middle region of human TPH2

Application

Anti-TPH2 antibody produced in rabbit has been used in Western blot analysis.

Actions biochimiques/physiologiques

Tryptophan hydroxylase (TPH; EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility. This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. The human genome contains two related tryptophan hydroxylases, one on chromosome 11p15-p14 and one on chromosome 12q21. This gene is expressed predominantly in the brain stem. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by the mouse ortholog. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1805 AY098914.1 1-1805 1806-2360 AC090109.15 122981-123535

Séquence

Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Tryptophan hydroxylase 2 (TPH2) gene variants associated with ADHD.
Sheehan K
Molecular Psychiatry, 10(10), 944-949 (2005)
Extensive juvenile "babysitting" facilitates later adult maternal responsiveness, decreases anxiety, and increases dorsal raphe tryptophan hydroxylase-2 expression in female laboratory rats.
Harding KM and Lonstein JS
Developmental Psychobiology, 58(4), 492-508 (2016)
Support for the involvement of TPH2 gene in affective disorders.
Harvey M
Molecular Psychiatry, 9(11), 980-981 (2004)
SNP and haplotype analysis of a novel tryptophan hydroxylase isoform (TPH2) gene provide evidence for association with major depression.
Zill P
Molecular Psychiatry, 9(11), 1030-1036 (2004)
Robust and tissue-specific expression of TPH2 versus TPH1 in rat raphe and pineal gland.
Patel PD
Biological Psychiatry, 55(4), 428-433 (2004)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique