Accéder au contenu
Merck
Toutes les photos(8)

Principaux documents

SAB1404621

Sigma-Aldrich

Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse

clone 6F7, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

CARD3, CARDIAK, CCK, GIG30, RICK, RIP2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6F7, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~38.21 kDa

Espèces réactives

mouse, human, rat

Technique(s)

capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RIPK2(8767)

Catégories apparentées

Description générale

Receptor interacting serine/threonine kinase 2 (RIPK2) belongs to the RIP kinase family. The protein contains a caspase activation and recruitment domain (CARD) at the C-terminal, N-terminal kinase domain, and a bridging intermediate domain. The gene is mapped to human chromosome 8q21.3.
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. (provided by RefSeq)

Immunogène

RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Application

Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse has been used in immunoblotting (1:500).

Actions biochimiques/physiologiques

Receptor interacting serine/threonine kinase 2 (RIPK2) is a key regulator of the immune and inflammatory pathways. It is a potent activator of nuclear factor (NF)-κB via nucleotide-binding and oligomerization domain (NOD) receptor. RIPK2 is associated with the progression and aggressiveness, tumor size, metastasis, and overall stagging in various types of cancers. Overexpression of RIPK2 is observed in the head and neck squamous cell carcinoma (HNSCC), gastric cancer, colorectal cancer (CRC), and lethal prostate cancers. It is found to induce cell proliferation and inhibit apoptosis in glioma and breast cancer. RIPK2 polymorphism is also associated with the onset of bladder cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Vivek Misra
Annals of neurosciences, 21(2), 69-73 (2014-09-11)
Available research data in Autism suggests the role of a network of brain areas, often known as the 'social brain'. Recent studies highlight the role of genetic mutations as underlying patho-mechanism in Autism. This mini review, discusses the basic concepts
Lucien P Garo et al.
Nature communications, 12(1), 2419-2419 (2021-04-25)
Chronic inflammation can drive tumor development. Here, we have identified microRNA-146a (miR-146a) as a major negative regulator of colonic inflammation and associated tumorigenesis by modulating IL-17 responses. MiR-146a-deficient mice are susceptible to both colitis-associated and sporadic colorectal cancer (CRC), presenting

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique