SAB1404503

Monoclonal Anti-TYMS antibody produced in mouse

clone 2B2, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : HsT422, MGC88736, TMS, TS, TSase
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2B2, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.11 kDa
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès NCBI: BC013919
• Numéro d'accès UniProt: P04818
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TYMS(7298)

Description

Description générale

The gene encoding thymidylate synthetase (TYMS) is localized on human chromosome 18p11.32.

Immunogène

TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC

Actions biochimiques/physiologiques

Thymidylate synthetase (TYMS) has a role in DNA replication and thymidylate biosynthesis. It is also involved in cell survival and proliferation. TYMS takes part in folate metabolism. The protein methylates deoxyuridylate to deoxythymidylate.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable