SAB1403598

Monoclonal Anti-BAG1, (C-terminal) antibody produced in mouse

clone 4C10, purified immunoglobulin, buffered aqueous solution

• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4C10, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.66 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG
• Numéro d'accès NCBI: NM_004323
• Numéro d'accès UniProt: Q99933
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... BAG1(573)

Description

Description générale

The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least three protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site, and alternative, downstream, AUG translation initiation sites. (provided by RefSeq)

Immunogène

BAG1 (NP_004314, 241 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable