Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1402973

Sigma-Aldrich

Monoclonal Anti-PXDN antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

D2S448, D2S448E, KIAA0230, MG50, PRG2, PXN, VPO

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2C11, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~38.21 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PXDN(7837)

Description générale

Drosophila peroxidasin is an extracellular matrix-associated peroxidase (Horikoshi et al., 1999 [PubMed 10441517]). It is expressed exclusively in hemocytes derived from head mesoderm at a very early stage of differentiation. Peroxidasin exists as a homotrimer with a unique hybrid structure that combines an enzymatically functional peroxidase domain with motifs that are typically found in extracellular matrix-associated proteins. It is a secreted protein that contains a secretory recognition sequence at its N terminus. Peroxidasin catalyzes hydrogen peroxide-driven radioiodination, oxidations, and the formation of dityrosine in vitro. It is also thought to function in extracellular matrix consolidation, phagocytosis, and defense.[supplied by OMIM] Peroxidasin (PXDN) is a multidomain, glycosylated, homotrimeric peroxidase. It is expressed in the endoplasmic reticulum and secreted into the extracellular matrix. The 1479-amino acid protein belongs to the peroxidase-cyclooxygenase superfamily. It possesses a catalytic peroxidase domain (POX), a leucine-rich repeat domain (LRR), four C-like immunoglobulin domains (Ig) at the amino-terminal and a carboxy-terminal von Willebrand factor type C module (VWC). The gene encoding PXDN has 23 exons and is localized on human chromosome 2p25.3.

Immunogène

PXDN (XP_056455, 1452 a.a. ~ 1561 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK

Actions biochimiques/physiologiques

Peroxidasin (PXDN) releases hypobromous acid, which is involved in collagen IV reinforcement. The protein stabilizes the basement membrane by enhancing the covalent crosslinks in the collagen IV network. Mutations in the gene encoding PXDN have been linked to microphthalmia and anterior segment dysgenesis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jodi Dougan et al.
International journal of molecular sciences, 20(12) (2019-06-27)
Peroxidasin (PXDN), a human homolog of Drosophila PXDN, belongs to the family of heme peroxidases and has been found to promote oxidative stress in cardiovascular tissue, however, its role in prostate cancer has not been previously elucidated. We hypothesized that
Microduplications Disrupting the MYT1L Gene (2p25.3) are Associated with Schizophrenia
Yohan Lee
Psychiatric Genetics (2012)
Selene Colon et al.
American journal of physiology. Renal physiology, 316(2), F360-F371 (2018-12-20)
Renal fibrosis is the pathological hallmark of chronic kidney disease (CKD) and manifests as glomerulosclerosis and tubulointerstitial fibrosis. Reactive oxygen species contribute significantly to renal inflammation and fibrosis, but most research has focused on superoxide and hydrogen peroxide (H2O2). The
Novel mutations in PXDN cause microphthalmia and anterior segment dysgenesis.
Choi A
European Journal of Human Genetics (2015)
Pre-steady-state Kinetics Reveal the Substrate Specificity and Mechanism of Halide Oxidation of Truncated Human Peroxidasin 1.
Paumann-Page M
The Journal of Biological Chemistry (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique