SAB1402084

Monoclonal Anti-SLC13A5 antibody produced in mouse

clone 2G4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : DKFZp686E17257, MGC138356, NACT
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2G4, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès NCBI: NM_177550
• Numéro d'accès UniProt: Q86YT5
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SLC13A5(284111)

Description

Description générale

The solute carrier family 13 member 5 (SLC13A5) gene is mapped to human chromosome 17p13.1. It is highly expressed in the plasma membrane of hepatocytes and is also expressed in the cells of testis and brain.

Immunogène

SLC13A5 (NP_808218, 152 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK

Actions biochimiques/physiologiques

SLC13A5 (solute carrier family 13 member 5) is a sodium-coupled citrate transporter. Its function involves the transportation of citrate from the bloodstream into the liver. The expression of the gene is found to be increased in obesity and non-alcoholic fatty liver disease. Downregulation of SLC13A5 promotes AMPK (adenosine monophosphate-activated protein kinase) activation and inhibits ACLY (ATP citrate lyase) expression. SLC13A5 is thus found to regulate homeostasis of energy and lipid in liver cancer, as the gene is associated with synthesis of fatty acids and cholesterol. Mutation in the SLC13A5 gene leads to early occurrence of epilepsy, developmental delay and tooth dysplasia in children.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable