SAB1401793

Monoclonal Anti-FKBP10 antibody produced in mouse

clone 1C6, ascites fluid

• Synonyme(s) : FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 1C6, monoclonal
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; western blot: 1:500-1:1000
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_021939
• Numéro d'accès UniProt: Q96AY3
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Informations sur le gène: human ... FKBP10(60681)

Description

Description générale

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. (provided by RefSeq)

Immunogène

FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Clear solution

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable