MSST0057

SILu^™Prot IL8, Interleukin-8 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Synonyme(s) : C-X-C motif chemokine 8 chemokine (C-X-C motif), Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), IL-8, Monocyte-derived neutrophil, Monocyte-derived neutrophil-activating peptide (MONAP), Neutrophil-activating protein 1 (NAP-1), Protein 3-10C, T-cell chemotactic factor, chemotactic factor (MDNCF), ligand 8
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.32

Propriétés

• Produit recombinant: expressed in HEK 293 cells
• Niveau de qualité: 200
• Pureté: ≥95% (SDS-PAGE)
• Forme: lyophilized powder
• Puissance: ≥98% (Heavy amino acids incorporation efficiency by MS)
• Adéquation: suitable for mass spectrometry (standard)
• Numéro d'accès UniProt: P10145
• Conditions d'expédition: ambient
• Température de stockage: −20°C
• Informations sur le gène: human ... CXCL8(3576)

Description

Description générale

SILu^™Prot IL8 is a recombinant, stable isotope-labeled human CXCL8 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of CXCL8 in mass-spectrometry. SILu^™Prot IL8 is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product′s datasheet.

Actions biochimiques/physiologiques

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

Séquence

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable