Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

MSST0006

Sigma-Aldrich

SILuLite VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonyme(s) :

SILuLite Vascular endothelial growth factor A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in HEK 293 cells

Pureté

≥98% (SDS-PAGE)

Forme

lyophilized powder

Technique(s)

mass spectrometry (MS): suitable

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... VEGFA(7422)

Description générale

SILu Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.


Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Actions biochimiques/physiologiques

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4

Séquence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique