HPA043484

Anti-SRSF5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Hrs, Anti-Serine/arginine-rich splicing factor 5, Anti-Sfrs5, Anti-Srp40
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA043484
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human, rat, mouse
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE
• Numéro d'accès UniProt: Q13243
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SRSF5(6430)

Description

Description générale

Serine and arginine rich splicing factor 5 (SRSF5) is encoded by the gene mapped to human chromosome 14. The encoded protein belongs to the SR protein family and is ubiquitously expressed.

Immunogène

serine/arginine-rich splicing factor 5 recombinant protein epitope signature tag (PrEST)

Application

Anti-SRSF5 antibody produced in rabbit has been used in immunoblotting (1:1000 dilution).

Actions biochimiques/physiologiques

Serine and arginine rich splicing factor 5 (SRSF5) is a major splicing regulator of human immunodeficiency virus type 1 (HIV-1) mRNA. It functions as a potential diagnostic marker for small-cell lung cancer and pleural metastatic cancer. Increased expression of SRSF5 boosts lamin A mRNA production in HeLa cells and fibroblasts of patients with hutchinson gilford progeria syndrome (HGPS), which is a rare genetic disease leading to accelerated aging. Thus, this protein acts as a potential therapeutic perspective for premature aging.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST84343

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable