HPA026816
Anti-SEC11C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-SEC11 homolog C (S. cerevisiae), Anti-SEC11L3, Anti-SPC21, Anti-SPCS4C
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
recombinant expression
Learn more about Antibody Enhanced Validation
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... SEC11C(90701)
Description générale
SEC11 homolog C (SEC11C), mapped to human chromosome 18, encodes signal peptidase complex subunit 21 (SPC21) protein. The encoded protein is characterized with two hydrophobic domains, one at amino terminal end between signal peptidase complex 18 (SPC 18) residues 17-57, which functions as a transmembrane anchor and other hydrophobic domain is mapped between SPC 18 residues 144 and 176.
Immunogène
SEC11 homolog C (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Application
Anti-SEC11C antibody has been used in western blotting.
Anti-SEC11C antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Actions biochimiques/physiologiques
In gastric cancer, SPC18 (signal peptidase complex 18) protein, coded by SEC11C (SEC11 homolog C, signal peptidase complex subunit), helps in the development through TGF-α(transforming growth factor alpha)secretion. SPC proteins present in vitro may participate in the mechanism of signal peptide processing and protein translocation.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST70171
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.
Zhang R, et al.
Nature, 535(7610), 164-164 (2016)
Signal peptidase complex 18, encoded by SEC11A, contributes to progression via TGF-a secretion in gastric cancer.
Oue N
Oncogene, 33(30), 3918-3926 (2014)
Paco Hulpiau et al.
Cellular and molecular life sciences : CMLS, 73(5), 1103-1116 (2015-09-18)
Paracaspases and metacaspases are two families of caspase-like proteins identified in 2000. Up until now paracaspases were considered a single gene family with one known non-metazoan paracaspase in the slime mold Dictyostelium and a single animal paracaspase called MALT1. Human
Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein.
Shelness GS, Blobel G
The Journal of Biological Chemistry, 265(16), 9512-9519 (1990)
Rong Zhang et al.
Nature, 535(7610), 164-168 (2016-07-08)
Flaviviruses infect hundreds of millions of people annually, and no antiviral therapy is available. We performed a genome-wide CRISPR/Cas9-based screen to identify host genes that, when edited, resulted in reduced flavivirus infection. Here, we validated nine human genes required for
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique