HPA018215
Anti-GUCA2A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-Gap-I, Anti-Guanylate cyclase activator 2A, Anti-Guanylate cyclase-activating protein 1, Anti-Guanylin precursor
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
Technique(s)
immunohistochemistry: 1:1000-1:2500
western blot: 0.04-0.4 μg/mL
Séquence immunogène
SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... GUCA2A(2980)
Description générale
The gene guanylate cyclase activator 2A (GUCA2A) is mapped to human chromosome 1p35-p34. GUCA2A mRNA is mainly detected in the gastrointestinal tract and kidney.
Immunogène
Guanylin precursor recombinant protein epitope signature tag (PrEST)
Actions biochimiques/physiologiques
Guanylate cyclase activator 2A (GUCA2A) is mainly an intestinal peptide hormone and endogenous ligand of guanylyl cyclase C. It is produced as prohormone proguanylin. In the intestine, GUCA2A along with guanylate cyclase C receptor activates epithelial cells. Activation of this pathway results in secretion of Cl- and HCO3- and inhibition of Na+ absorption, which drives water secretion into the intestinal lumen. In the renal tissue GUCA2A elicits natriuresis, kaliuresis, and diuresis, along with increasing urinary cyclic guanosine monophosphate (cGMP) levels. GUCA2A is suggested to elevate the exrection of urinary salt and water, which results in the prevention of hypernatremia and hypervolemia following increased salt uptake by the body. The protein is also expressed in epithelial cells of the ductal system of human parotid and submandibular glands. It is released into the saliva through salivary duct cells. GUCA2A is highly expressed in salivary gland tumors. On the other hand, GUCA2A is down-regulated in colorectal cancer.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST72418
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Thomas Mueller et al.
Kidney international, 82(12), 1253-1255 (2012-12-04)
According to a proposed concept of a gastrointestinal-renal natriuretic signaling axis, natriuretic peptides are released from the intestine into the circulation in response to oral salt intake and act on the kidneys as hormones to increase sodium excretion. The peptides
Øystein Brenna et al.
Cell and tissue research, 365(2), 331-341 (2016-04-06)
Guanylin (GUCA2A/Guca2a/GN) and uroguanylin (GUCA2B/Guca2b/UGN) are expressed in the gastrointestinal tract and have been implicated in ion and fluid homeostasis, satiety, abdominal pain, growth and intestinal barrier integrity. Their cellular sources are debated and include goblet cells, entero-/colonocytes, enteroendocrine (EE)
Amanda M Pattison et al.
Cancer biology & therapy, 21(9), 799-805 (2020-07-01)
Most sporadic colorectal cancer reflects acquired mutations in the adenomatous polyposis coli (APC) tumor suppressor gene, while germline heterozygosity for mutant APC produces the autosomal dominant disorder Familial Adenomatous Polyposis (FAP) with a predisposition to colorectal cancer. In these syndromes
Øystein Brenna et al.
Scandinavian journal of gastroenterology, 50(10), 1241-1252 (2015-05-17)
Activation of membrane receptor guanylate cyclase-C (GC-C) is implicated in gastrointestinal fluid and electrolyte balance, preservation of intestinal barrier integrity, anti-trophic effects and inhibition of pain sensation. To evaluate GC-C signaling, we examined the regulation of GC-C (GUCY2C/Gucy2c) and its
Yin-bo Chen et al.
Zhonghua wei chang wai ke za zhi = Chinese journal of gastrointestinal surgery, 12(5), 515-517 (2009-09-11)
To investigate the expression of guanylin in colorectal cancer. The expression of guanylin was examined by RT-PCR and semiquantitative analysis in 20 cases of colorectal cancer, and its relationship with clinical characteristics was analyzed. The positive expression of guanylin in
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique