Accéder au contenu
Merck
Toutes les photos(9)

Principaux documents

HPA018139

Sigma-Aldrich

Anti-GOT2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Aspartate aminotransferase, mitochondrial precursor, Anti-FABP-1, Anti-FABPpm, Anti-Fatty acid-binding protein, Anti-Glutamate oxaloacetate transaminase 2, Anti-Transaminase A, Anti-mAspAT

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

mouse, rat, human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GOT2(2806)

Description générale

The gene glutamate oxaloacetate transaminase-2 (GOT2) is located in human chromosome 16 (16q21). The protein is an aspartate aminotransfaerase (AST) enzyme. Two distinct forms of AST have been identified: a cytoplasmic (GOT1) and a mitochondrial isoform (GOT2). GOT2 has been identified within mitochondria and on the plasma membrane in HepG2 cells.

Immunogène

Aspartate aminotransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-GOT2 antibody produced in rabbit has been used in western blotting and immunohistochemistry.

Actions biochimiques/physiologiques

The protein Glutamate oxaloacetate transaminase-2 (GOT2) participates in amino acid metabolism, converting aspartate and α-ketoglutarate (aKG) to oxaloacetate (OAC) and glutamate. GOT2 also provides a major route for reducing equivalents into mitochondria through its participation in the malate:asparte shuttle. GOT2K159 acetylation increases in human pancreatic tumors. It is shown to be involved in growth of human pancreatic adenocarcinoma. Long term ethanol exposure up-regulates GOT2 levels in the plasma membrane of HepG2 cells. The protein level increases in type2 diabetes patients post exercise training. Using mass spectroscopy and nuclear magnetic resonance approach decreased level of the enzyme was observed in brains from schizophrenia-induced rats and post-mortem schizophrenia patients. Proteomic analysis of Vastus lateralis muscle in mature and older women showed down-regulation of the protein in older women, indicating its involvement in muscle aging.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73325

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sophie E Hussey et al.
Medicine and science in sports and exercise, 45(6), 1069-1076 (2013-01-01)
Exercise training alters protein abundance in the muscle of healthy individuals, but the effect of exercise on these proteins in patients with type 2 diabetes (T2D) is unknown. The aim of this study was to determine how exercise training alters
Hendrik Wesseling et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 38(12), 2532-2544 (2013-08-15)
Current schizophrenia (SCZ) treatments fail to treat the broad range of manifestations associated with this devastating disorder. Thus, new translational models that reproduce the core pathological features are urgently needed to facilitate novel drug discovery efforts. Here, we report findings
Laëtitia Théron et al.
Molecular & cellular proteomics : MCP, 13(1), 283-294 (2013-11-13)
Sarcopenia corresponds to the loss of muscle mass occurring during aging, and is associated with a loss of muscle functionality. Proteomic links the muscle functional changes with protein expression pattern. To better understand the mechanisms involved in muscle aging, we
HIF1 alpha suppresses tumor cell proliferation through inhibition of aspartate biosynthesis
Melendez R F, et al.
Testing, 26(9), 2257-2265 (2019)
Silvia Sookoian et al.
World journal of gastroenterology, 21(3), 711-725 (2015-01-28)
For several decades, serum levels of alanine (ALT) and aspartate (AST) aminotransferases have been regarded as markers of liver injury, including a wide range of etiologies from viral hepatitis to fatty liver. The increasing worldwide prevalence of metabolic syndrome and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique