HPA017653

Anti-DNAJC14 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-DRiP78, Anti-DnaJ homolog subfamily C member 14, Anti-DnaJ protein homolog 3, Anti-Dopamine receptor-interacting protein of 78 kDa, Anti-HDJ-3
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA017653
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: mouse, rat, human
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
• Numéro d'accès UniProt: Q6Y2X3
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... DNAJC14(85406)

Description

Description générale

DNAJC14 (DnaJ heat shock protein family (Hsp40) member C14) belongs to Hsp40 chaperone family. The protein contains 70-amino acid motif called J-domain and a C- terminal domain. J-domain facilitates ATP hydrolysis during chaperoning process. The gene coding for DNAJC14 protein is mapped to human chromosome 12q13.2.

Immunogène

DnaJ homolog subfamily C member 14 recombinant protein epitope signature tag (PrEST)

Application

Anti-DNAJC14 antibody produced in rabbit has been used for immunofluorescence studies and western blot analysis. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

DNAJC14 (DnaJ heat shock protein family (Hsp40) member C14) chaperone protein interacts with dopamine D1 receptor and regulates receptor trafficking between endoplasmic reticulum (ER) and plasma membrane. It also modulates the life cycles of various Flaviviridae family members and Flavivirus replication. DNAJC14 helps in SNARE (Soluble N-ethylmaleimide-sensitive factor activating protein receptor) complex-mediated transport by interacting with the lysosomal trafficking regulator protein.
DNAJC14 plays an important role in regulating yellow fever virus (YFV) replication complex assembly. The DNAJC family protein are also involved in various biological processes such as translation, exocytosis and endocytosis.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72886

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)