HPA015267

Anti-CDK14 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-PFTK1, Anti-Serine/threonine-protein kinase PFTAIRE-1
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA015267
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Séquence immunogène: DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PFTK1(5218)

Description

Description générale

CDK14 (cyclin-dependent kinase 14) belongs to a 21 member cyclin dependent kinase gene family. It is also called PFTK1 or PFTAIRE1. This family contains two groups- 10 classical CDKs and the rest 11 are members of a new group. This gene is localized to human chromosome 7q21.13, and has a high expression level in brain, heart, pancreas, kidney, ovaries and testis. In lungs, it is expressed in bronchial and alveolar epithelium.

Immunogène

Serine/threonine-protein kinase PFTAIRE-1 recombinant protein epitope signature tag (PrEST)

Application

Anti-CDK14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Actions biochimiques/physiologiques

CDK14 (cyclin-dependent kinase 14) facilitates cell division, and also has functions as an oncogene. In hepatocellular carcinoma, it aids in tumor growth and metastasis. It is overexpressed in esophageal squamous cell carcinoma (ESCC), and this is related to poor response to chemotherapy. It has potential as a marker for prognosis as well as response to chemotherapy in ESCC. Studies in mice show that cigarette smoke leads to reduced expression of this protein in both testicular and lung cells. In lungs, this results in decreased β-catenin, resulting in aberrant Wnt signaling. Studies in mice also show that this protein is involved in meiosis and differentiation of neuronal cells. It phosphorylates caldesmon, an actin-binding protein, and thus facilitates the binding of actin molecules, and the formation of stress fibers.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73464

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)