HPA014711

Anti-EMP2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-EMP-2, Anti-Epithelial membrane protein 2, Anti-Protein XMP
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA014711

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Numéro d'accès UniProt: P54851
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... EMP2(2013)

Description

Description générale

EMP2 (epithelial membrane protein 2) belongs to the family of four-transmembrane domains proteins called growth arrest-specific gene 3 (GAS-3)/peripheral myelin protein 22 (PMP22). It is a transmembrane protein, which spans the membrane four times. It is predominantly expressed in secretory endometrium, alveolar epithelium in lungs, and in eye in the retinal pigmented epithelium. This protein has three predicted N-linked glycosylation sites, two exoplasmic domains, and a short cytolsolic tail. It is a tumor suppressor gene for certain cancers such as, B-cell lymphoma.

Immunogène

Epithelial membrane protein 2 recombinant protein epitope signature tag (PrEST)

Sequence
DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

EMP2 (epithelial membrane protein 2) is involved in blastocyst implantation, where it controls the surface expression and localization of integrin αvβ3. It is up-regulated in endometrioid ovarian tumors, which is associated with poor prognosis and survival. It is involved in controlling the correct trafficking of glycolipids and multiple proteins from post-Golgi endosomes to plasma membrane. It also regulates the proper trafficking of specific molecules to glycolipids-enriched lipid raft microdomains (GEMs). It interacts with and activates focal adhesion kinase (FAK) and the FAK/Src complex, which in turn facilitates collagen gel contraction. This gene is also down-regulated in nasopharyngeal carcinoma (NPC), especially in high grade cases. In NPC, it might be involved in increases tumor aggressiveness, and poor prognosis. It is highly up-regulated in triple negative breast cancer and invasive breast cancer. It might have potential as a therapeutic target for the same.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73193

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)