Accéder au contenu
Merck
Toutes les photos(11)

Documents

HPA011271

Sigma-Aldrich

Anti-ANXA1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Annexin A1, Anti-Annexin I, Anti-Annexin-1, Anti-Calpactin II, Anti-Chromobindin-9, Anti-Lipocortin I, Anti-Phospholipase A2 inhibitory protein, Anti-p35

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

mouse, rat, human

Validation améliorée

orthogonal RNAseq
independent
RNAi knockdown
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

Séquence immunogène

FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ANXA1(301)

Description générale

Annexin A1 (ANXA1) belongs to the annexin gene family and is a part of the A subfamily. It is a glucocorticoid-regulated, calcium and phospholipid-binding protein. This protein has a molecular weight of 37kDa.

Immunogène

Annexin A1 recombinant protein epitope signature tag (PrEST)

Application

Anti-ANXA1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

Annexin A1 (ANXA1) is involved in multiple cellular functions such as, cell proliferation and differentiation and signal transduction. Its expression is deregulated in various cancers such as, glial tumors, nasopharyngeal carcinoma, head and neck, larynx, esophageal, breast, hepatocellular, gastric, prostate and pancreatic cancer. It is up-regulated in rectal cancer and predicts poor prognostic response to concurrent chemoradiotherapy. ANXA1 is involved in anti-inflammatory processes, and regulates apoptosis and phagocytosis of apoptotic bodies. Its expression levels are altered in cystic fibrosis, and might be involved in the pathogenesis of glomerular disorders. It has potential as a marker for the diagnosis and prognosis of glomerular disorders. ANXA1 has a high level of expression in normal gastrointestinal epithelium, and might be involved in the maintenance of cellular boundaries. It also regulates gastric cancer cell proliferation and viability through COX2 (cyclooxygenase 2) pathway.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71575

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Invasion of murine annexin A1 in bovine ovarian cortex tissue during short-time xenotransplantation in conventional and immune deficient mice
Bartholomeus E
Reproduction, Fertility, and Development, 27(1), 175-176 (2014)
Yanyan Wang et al.
Journal of cellular physiology, 234(8), 13629-13638 (2019-01-05)
The discovery of cysteine-rich secretory protein 3 (CRISP3) has been made in human neutrophils for the first time. Cloning of the complementary DNA (cDNA) for CRISP3 was performed from a cDNA library of human bone marrow. In patients with mammary
Differential expression of ANXA1 in benign human gastrointestinal tissues and cancers.
Gao Y, Chen Y, Xu D, et al.
BMC Cancer, 14, 520-520 (2014)
Aifeng Liu et al.
Molecular medicine reports, 10(6), 3059-3067 (2014-10-18)
Nasopharyngeal carcinoma (NPC) has a highly increased incidence rate (20/100,000) in Southern regions of China, while being rare in the rest of the world. NPC is a malignant type of cancer due to its high occurrence rate of metastasis; however
Yanyan Wang et al.
Journal of cellular physiology, 234(8), 13629-13638 (2019-01-05)
The discovery of cysteine-rich secretory protein 3 (CRISP3) has been made in human neutrophils for the first time. Cloning of the complementary DNA (cDNA) for CRISP3 was performed from a cDNA library of human bone marrow. In patients with mammary

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique