HPA010979

Anti-CDCP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-CD318 antigen, Anti-CUB domain-containing protein 1 precursor, Anti-Membrane glycoprotein gp140, Anti-SIMA135, Anti-Subtractive immunization M plus HEp3-associated 135 kDa protein, Anti-Transmembrane and associated with src kinases
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA010979

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunohistochemistry: 1:50- 1:200
• Séquence immunogène: GFSIANRSSIKRLCIIESVFEGEGSATLMSANYPEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDKQPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERA
• Numéro d'accès UniProt: Q9H5V8
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CDCP1(64866)

Description

Description générale

CUB-domain-containing protein 1 (CDCP1) is a type I transmembrane protein which functions as a substrate for Src kinases. It has a molecular weight of 140kDa, and has a proteolytically cleaved form with a molecular weight of 85kDa. It has an intracellular region made of five tyrosines, and a large extracellular region containing the CUB (C1r/C1s, Uegf, Bmp1) domain. Both the isoforms of CDCP1 are expressed in varying ratios in epithelial cells. This gene is localized to human chromosome 3p21.31. CDCP1 protein is composed of 836 amino acids, with a signal peptide of 29 amino acids, and a cytoplasmic domain consisting of 150 amino acids.

Immunogène

CUB domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

CUB domain-containing protein 1 (CDCP1) is phosphorylated by Src kinases and mediates resistance to anoikis, promotes degradation of extracellular matrix, tumor invasion and metastasis. It is a cancer associated gene and is up-regulated in multiple cancers such as, lung, pancreas and kidney. Its overexpression in these cancers is related to poor prognosis. CDCP1 inhibits integrin-mediated cell adhesion by acting as a substrate of Src-kinases. It also facilitates the metastasis of melanoma, and is associated with poor prognosis of renal cell carcinoma. CDCP1 aids bone morphogenetic protein 4 (BMP4) in initiating epithelial-mesenchymal transition, and suppresses the epithelial phenotype of pancreatic cancer cells. It confers anoikis resistance to lung cancer cells by participating in protein kinase Cδ (PKCδ) signaling.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72142

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)