Accéder au contenu
Merck
Toutes les photos(9)

Principaux documents

HPA001636

Sigma-Aldrich

Anti-TJP1 antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Tight junction protein 1 antibody produced in rabbit, Anti-Tight junction protein ZO-1 antibody produced in rabbit, Anti-Zona occludens 1 protein antibody produced in rabbit, Anti-Zonula occludens 1 protein antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL

Séquence immunogène

RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TJP1(7082)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

Tight junction protein 1/Zona occludens 1 protein (TJP1, ZO-1) is a membrane-associated guanylate kinase, associated with cytoplasmic membrane surface of intercellular tight junctions. ZO-1 gene is mapped to human chromosome 15q13.1. It comprises a guanylate kinase (GUK) domain, three postsynaptic density 95/disc-large/ZO-1 (PDZ) domains, a Src homology 3 domain, actin-binding region and an acidic domain. ZO-1 is observed in the tight junctions associated with epithelia and endothelia.

Spécificité

Rabbit polyclonal anti-TJP1 antibody reacts with human tight junction protein 1/zona occludens 1 protein.

Immunogène

Tight junction protein ZO-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Rabbit polyclonal anti-TJP1 antibody is used to tag tight junction protein 1/zona occludens 1 protein for detection and as a probe to determine the presence and roles of tight junction protein 1/zona occludens 1 protein in cell remodeling and tissue organization. It has been used in:
  • immunofluorescent staining
  • immunohistochemistry
  • confocal microscopy
  • immunofluorescence
  • western blotting
  • immunocytochemistry
  • immunoprecipitation

Actions biochimiques/physiologiques

Tight junction protein 1/Zona occludens 1 protein (TJP1/ZO-1) mediates the regulation of cell remodeling and tissue organization in both the embryonic and extraembryonic regions. It binds with other proteins including junctional adhesion molecule (JAM), claudins and occludin. ZO-1 deficiency also favors apoptosis in the embryonic cells. Silencing of the ZO-1 by the microRNA (miR-103) increases endometrial carcinogenesis and could be a potential therapeutic target. The levels of ZO-1 are elevated in hepatocellular carcinoma.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST83050

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Les clients ont également consulté

Huanhuan Joyce Chen et al.
Lab on a chip, 18(14), 2036-2046 (2018-06-09)
We describe an expanded modular gastrointestinal (GI) tract-liver system by co-culture of primary human intestinal epithelial cells (hIECs) and 3D liver mimic. The two organ body-on-chip design consisted of GI and liver tissue compartments that were connected by fluidic medium
MicroRNA-103 regulates the progression in endometrial carcinoma through ZO-1
Du J, et al.
International Journal of Immunopathology and Pharmacology, 33, 2058738419872621-2058738419872621 (2019)
Innate immune response of human pluripotent stem cell-derived airway epithelium
McIntyre BAS, et al.
Innate Immunity, 21(5), 504-511 (2015)
Increased systemic zonula occludens 1 associated with inflammation and independent biomarker in patients with hepatocellular carcinoma
Ram AK, et al.
BMC Cancer, 18(1), 1-10 (2018)
Genome-wide association study of patient and clinician rated global impression severity during antipsychotic treatment
Clark, et al.
Pharmacogenetics and Genomics, 23(2), 69-69 (2013)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique