Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV51755

Sigma-Aldrich

Anti-SEPT9 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-AF17q25, Anti-KIAA0991, Anti-MSF, Anti-MSF1, Anti-NAPB, Anti-PNUTL4, Anti-SINT1, Anti-Septin 9

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

37 kDa

Espèces réactives

human, rat, guinea pig, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

Immunogène

Synthetic peptide directed towards the C terminal region of human SEPT9(septin 9)

Application

Anti-SEPT9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

Septin 9 (SEPT9; SeptD1) is a member of the septin family and is involved in cell cycle control and cytokinesis. Members of this family form complexes and filamentous structures that maintain the cytoskeleton. The septin proteins act as scaffolds to recruit proteins to specific cellular locations. Septin 9 interacts with bundle microtubules and is altered in neuralgic amyotrophy. It has been found to be hypermethylated in certain cancers.

Séquence

Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Septins.
Mathew P Estey et al.
Current biology : CB, 21(10), R384-R387 (2011-05-24)
Reinhold Wasserkort et al.
BMC cancer, 13, 398-398 (2013-08-31)
The septin 9 gene (SEPT9) codes for a GTP-binding protein associated with filamentous structures and cytoskeleton formation. SEPT9 plays a role in multiple cancers as either an oncogene or a tumor suppressor gene. Regulation of SEPT9 expression is complex and
Xiaobo Bai et al.
The Journal of cell biology, 203(6), 895-905 (2013-12-18)
Septin 9 (SEPT9) interacts with microtubules (MTs) and is mutated in hereditary neuralgic amyotrophy (HNA), an autosomal-dominant neuropathy. The mechanism of SEPT9 interaction with MTs and the molecular basis of HNA are unknown. Here, we show that the N-terminal domain
Kirstin Sandrock et al.
Biological chemistry, 392(8-9), 751-761 (2011-07-20)
Septins constitute a group of GTP binding proteins that assemble into homo- and hetero-oligomeric complexes and filaments. These higher order septin structures are thought to function like scaffolds and/or diffusion barriers serving as spatial localizers for many proteins with key

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique