AV50803
Anti-ZNF385B antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-FLJ25270, Anti-ZNF533, Anti-Zinc finger protein 385B
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
41 kDa
Espèces réactives
guinea pig, rabbit, mouse, bovine, horse, human, rat, dog
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... ZNF385B(151126)
Description générale
The gene ZNF385B (Zinc finger protein 385B) is mapped to human chromosome 2q31.2-q31.3. It contains 4 matrin-type zinc fingers. It is present in the germinal center of lymph nodes. ZNF385B is expressed in spleen, lymph node and tonsil.
Immunogène
Synthetic peptide directed towards the C terminal region of human ZNF385B
Application
Anti-ZNF385B antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Actions biochimiques/physiologiques
Zinc finger protein 385B (ZNF385B; ZNF533) is a transcription factor. ZNF385B modulates transactivation of p53 and is involved in B-cell apoptosis. The expression of ZNF385B correlates with survival in ovarian carcinomas. Single nucleotide polymorphism in ZNF385B is associated with autism. Similarly, polymorphism in ZNF385B is also linked to nonsyndromic orofacial clefts (NSOC).
Séquence
Synthetic peptide located within the following region: HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Shuang Liang et al.
Journal of Zhejiang University. Science. B, 15(3), 264-271 (2014-03-07)
A study in a Caucasian population has identified two single-nucleotide polymorphisms (SNPs) in ZNF533, one in DOCK4, and two in IMMP2L, which were all significantly associated with autism. They are located in AUTS1 and AUTS5, which have been identified as
Jun Wu et al.
DNA and cell biology, 30(1), 47-54 (2010-09-21)
The etiology of nonsyndromic orofacial clefts (NSOC) has been considered "complex" or "multifactorial." Etiologic heterogeneity induces disparities in the results among different populations. The zinc finger protein 533 (ZNF533) and several environmental factors have been revealed to be associated with
Bente Vilming Elgaaen et al.
PloS one, 7(9), e46317-e46317 (2012-10-03)
The oncogenesis of ovarian cancer is poorly understood. The aim of this study was to identify mRNAs differentially expressed between moderately and poorly differentiated (MD/PD) serous ovarian carcinomas (SC), serous ovarian borderline tumours (SBOT) and superficial scrapings from normal ovaries
ZNF385B is characteristically expressed in germinal center B cells and involved in B-cell apoptosis.
Kazutoshi Iijima et al.
European journal of immunology, 42(12), 3405-3415 (2012-09-05)
We previously identified zinc finger (ZF) protein ZNF385B as a molecule specifically expressed in Burkitt's lymphoma (BL) among hematologic malignancies. Here, we investigated ZNF385B expression in healthy B cells in a variety of hematological tissues by RT-PCR and immunohistochemistry. ZNF385B
C D Constantinou-Deltas et al.
Genomics, 12(3), 581-589 (1992-03-01)
The zinc finger motif is a highly conserved tandemly repeated sequence of 28-30 amino acids that was first identified in transcription factor TFIIIA from Xenopus laevis. Subsequently, similar motifs were found and characterized in many genes from mammalian genomes and
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique