AV49937
Anti-ADAM33 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-ADAM metallopeptidase domain 33, Anti-DJ964F7.1, Anti-DKFZp434K0521, Anti-FLJ35308, Anti-FLJ36751, Anti-MGC149823, Anti-MGC71889
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
62 kDa
Espèces réactives
dog, rat, human, mouse, pig, horse
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... ADAM33(80332)
Description générale
ADAM metallopeptidase domain 33 (ADAM33) is a member of the ADAM (a disintegrin and metalloprotease domain) family. ADAM33 is largely expressed in mesenchymal cells including airway fibroblasts, myofibroblasts, and smooth muscle cells.
Immunogène
Synthetic peptide directed towards the middle region of human ADAM33
Application
Anti-ADAM33 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Actions biochimiques/physiologiques
The members of the ADAM (a disintegrin and metalloprotease domain) family are involved in cell-to-cell and cell-to-matrix interactions, neurogenesis and muscle development. The expression of ADAM33 has been linked to asthma and chronic obstructive pulmonary disease (characterised by chronic bronchitis and emphysema). ADAM33 is also associated with inflammation of the lungs which is activated against etiological viral agents.
Séquence
Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Emanuele Baurakiades et al.
Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology, 61(4), 585-589 (2014-12-03)
ADAM28, ADAM33, IL-13, IL-4 and other cytokines (IL-6 and IL-10) seem to play important roles in the persistence and maintenance of acute inflammatory processes that ultimately lead to lung remodeling and pulmonary fibrosis, which may be responsible for the high
Deng-Chuan Zhou et al.
Molecular biology reports, 42(2), 409-422 (2014-10-05)
A series of observational studies have been made to investigate the association of the ADAM33 gene polymorphisms with the risk of COPD, but their results were conflicting. Therefore, we performed an updated meta-analysis to quantitatively summarize the associations of ADAM33
Shelby P Umland et al.
American journal of respiratory cell and molecular biology, 29(5), 571-582 (2003-06-05)
We examined transcript expression and post-transcriptional regulation of human ADAM33, a recently identified asthma gene. A detailed messenger RNA (mRNA) expression profile was obtained using Northern, reverse transcription polymerase chain reaction, and in situ hybridization analyses. ADAM33 mRNA was expressed
Feng Lin et al.
Molecular medicine reports, 8(4), 1209-1215 (2013-08-13)
A disintegrin and metalloproteinase 33 (ADAM33) has been identified as an asthma susceptibility gene; however, the role of ADAM33 in the pathogenesis and progression of asthma remains to be elucidated. As ADAM33 is predominantly expressed in airway smooth muscle cells
Paul Van Eerdewegh et al.
Nature, 418(6896), 426-430 (2002-07-12)
Asthma is a common respiratory disorder characterized by recurrent episodes of coughing, wheezing and breathlessness. Although environmental factors such as allergen exposure are risk factors in the development of asthma, both twin and family studies point to a strong genetic
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique