Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV46812

Sigma-Aldrich

Anti-RTN4 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-ASY, Anti-NI220/250, Anti-NOGO, Anti-NOGO-A, Anti-NOGOC, Anti-NSP, Anti-NSP-CL, Anti-Reticulon 4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

42 kDa

Espèces réactives

human, rat, horse, mouse, sheep, pig, bovine, rabbit, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_997403

Numéro d'accès UniProt

Q9NQC3

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RTN4(57142)

Immunogène

Synthetic peptide directed towards the middle region of human RTN4

Application

Anti-RTN4 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mLl.

Actions biochimiques/physiologiques

RTN4 (reticulon 4) gene is a member of reticulon encoding genes family. It is expressed in oligodendrocytes and predominantly associates with the endoplasmic reticulum. It is a component of CNS white matter that inhibits the axonal regeneration and induces collapse in dorsal root ganglion growth cones. Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease that plays a pivotal role in the generation of amyloid beta-protein (Abeta). RTN4 interacts with BACE1 and blocks its activity.

Séquence

Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Kiyoko S Murayama et al.
The European journal of neuroscience, 24(5), 1237-1244 (2006-09-13)
Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease necessary for the generation of amyloid beta-protein (Abeta), which accumulates in the brains of individuals with Alzheimer's disease (AD). To gain insight into the mechanisms by which BACE1
T GrandPré et al.
Nature, 403(6768), 439-444 (2000-02-10)
Adult mammalian axon regeneration is generally successful in the peripheral nervous system (PNS) but is dismally poor in the central nervous system (CNS). However, many classes of CNS axons can extend for long distances in peripheral nerve grafts. A comparison
Min-Eun Park et al.
Vaccine, 32(40), 5221-5227 (2014-07-30)
The immunity and protective capability produced by vaccines can vary remarkably according to the kinds of adjuvants being used. In the case of foot-and-mouth disease (FMD) vaccines in pigs, only oil-adjuvant vaccines have been used, and these tend to show
Xuemei Chen et al.
Experimental neurology, 261, 267-277 (2014-07-30)
Yonkenafil is a novel phosphodiesterase type 5 (PDE5) inhibitor. Here we evaluated the effect of yonkenafil on ischemic injury and its possible mechanism of action. Male Sprague-Dawley rats underwent middle cerebral artery occlusion, followed by intraperitoneal or intravenous treatment with

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique