Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV46808

Sigma-Aldrich

Anti-MMP23B antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-MIFR, Anti-MIFR-1, Anti-MMP22, Anti-Matrix metallopeptidase 23B

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

36 kDa

Espèces réactives

guinea pig, bovine, human, mouse, dog, rat, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... MMP23B(8510)

Immunogène

Synthetic peptide directed towards the N terminal region of human MMP23B

Application

Anti-MMP23B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

MMP23B (matrix metallopeptidase 23B) gene encodes a single-pass type II membrane protein that belongs to matrix metalloproteinase (MMP) family and is expressed primarily in ovary, testis and prostate. Matrix metalloproteinase (MMP) family proteins facilitate the breakdown of extracellular matrix (ECM) components as well as processes cytokines and growth factors. Human MMP23B stimulates TNF shedding in a cell culture system. In zebrafish, Mmp23b plays a crucial role in augmenting liver development and hepatocyte proliferation via tumor necrosis factor pathway.

Séquence

Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

G Velasco et al.
The Journal of biological chemistry, 274(8), 4570-4576 (1999-02-13)
A cDNA encoding a new human matrix metalloproteinase (MMP), tentatively called MMP-23, has been cloned from an ovary cDNA library. This protein exhibits sequence similarity with MMPs, but displays a different domain structure. Thus, MMP-23 lacks a recognizable signal sequence
Fei Qi et al.
Hepatology (Baltimore, Md.), 52(6), 2158-2166 (2010-11-11)
The matrix metalloproteinase (MMP) family of proteins degrades extracellular matrix (ECM) components as well as processes cytokines and growth factors. MMPs are involved in regulating ECM homeostasis in both normal physiology and disease pathophysiology. Here we report the critical roles

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique