Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV46040

Sigma-Aldrich

Anti-CENPA antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Centromere protein A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD08705446
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

16 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_001035891

Numéro d'accès UniProt

P49450

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... CENPA(1058)

Immunogène

Synthetic peptide directed towards the N terminal region of human CENPA

Application

Anti-CENPA antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

Centromere protein A is encoded by gene CENPA which is a Histone H3-like protein that replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. It plays a pivotal role in recruiting and assembly of kinetochore proteins, mitotic progression and chromosome segregation. It acts as a prognostic marker for distant relapse in estrogen receptor-positive breast cancer.

Séquence

Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Susan L McGovern et al.
Breast cancer research : BCR, 14(3), R72-R72 (2012-05-09)
Centromere protein A (CENP-A), an essential centromere protein, has been associated with high grade cancers. This study was undertaken to determine if CENP-A is a prognostic factor for breast cancer patients not receiving systemic therapy or predictive of response to
Damien Goutte-Gattat et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(21), 8579-8584 (2013-05-10)
The role of the mitotic phosphorylation of the amino (NH2) terminus of Centromere Protein A (CENP-A), the histone variant epigenetic centromeric marker, remains elusive. Here, we show that the NH2 terminus of human CENP-A is essential for mitotic progression and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique