Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV44806

Sigma-Aldrich

Anti-USP48 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DKFZp762M1713, Anti-MGC132556, Anti-MGC14879, Anti-RAP1GA1, Anti-USP31, Anti-Ubiquitin specific peptidase 48

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

70 kDa

Espèces réactives

rat, guinea pig, rabbit, dog, mouse, horse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_115612

Numéro d'accès UniProt

Q86UV5-7

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... USP48(84196)

Immunogène

Synthetic peptide directed towards the C terminal region of human USP48

Application

Anti-USP48 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

Ubiquitin specific peptidase 48 (USP48; USP31) is a deubiquitinating enzyme that belongs to C19 peptidase family. It recognizes and hydrolyzes the peptide bond of ubiquitin at the C-terminal glycine. USP48 reportedly interacts with p65/RelA subunits of NF-κB and regulates its activation.

Séquence

Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

K D Wilkinson
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 11(14), 1245-1256 (1997-12-31)
An astounding number of important regulatory and structural proteins are subject to modification by the attachment of ubiquitin or ubiquitin-like proteins. This modification acts as a targeting signal, delivering the modified protein to different locations in the cell and modifying
Christos Tzimas et al.
Cellular signalling, 18(1), 83-92 (2005-10-11)
TRAF2 mediates activation of the transcription factors NF-kappaB and AP1 by TNF. A yeast two-hybrid screen of a human cDNA library identified a ubiquitin specific protease homologue (USP31) as a TRAF2-interacting protein. Two cDNAs encoding for USP31 were identified. One

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique