AV44398

Anti-ZDHHC13 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-FLJ10852, Anti-FLJ10941, Anti-HIP14L, Anti-HIP3RP, Anti-MGC64994, Anti-Zinc finger, DHHC-type containing 13
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 54 kDa
• Espèces réactives: mouse, guinea pig, rat, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_061901
• Numéro d'accès UniProt: Q8IUH4-3
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... ZDHHC13(54503)

Description

Description générale

Zinc finger, DHHC-type containing 13 (ZDHHC13, HIP14L, HIP3RP) is a Huntingtin-interacting protein that mediates the dual functions of palmitoyl acyltransferase and Mg²⁺ transport qualifying it as a chanzyme. Protein palmitoylation is important for the regulation of important cellular processes such as protein trafficking, stability, and protein-protein interactions. Improper palmitoylation may underlie diseases such as human alopecia, osteoporosis, and amyloidosis and many other neurodegenerative diseases caused by protein misfolding and amyloidosis.

Spécificité

Anti-ZDHHC13 polyclonal antibody reacts with chicken, human, mouse, rat, zebrafish, and bovine zinc finger, DHHC-type containing 13 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human ZDHHC13

Application

Anti-ZDHHC13 polyclonal antibody is used to tag zinc finger, DHHC-type containing 13 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of zinc finger, DHHC-type containing 13 in processes that involve Mg²⁺ transport and protein palmitoylation.

Actions biochimiques/physiologiques

ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Séquence

Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable